Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
Q6PEB9
(Coiled-coil domain-containing protein 127) with a FATCAT P-Value: 0.0 and RMSD of 2.97 angstrom. The sequence alignment identity is 80.8%.
Structural alignment shown in left. Query protein Q96BQ5 colored as red in alignment, homolog Q6PEB9 colored as blue.
Query protein Q96BQ5 is also shown in right top, homolog Q6PEB9 showed in right bottom. They are colored based on secondary structures.
Q96BQ5 MNNLNDPPNWNIRPNSRADGGDGSRWNYALLVPMLGLAAFRWIWSRESQKEVEKEREAYRRRTAAFQQDLEAKYHAMISENRRAVAQLSLELEKEQNRTA 100 Q6PEB9 MNNLNDPPNWNIQPNPRADGGDGSKWNYALLVPMLGLAAFRWIWSRESQKEIEKARRAYHQQTAAFQQDLDAKYHAVISEHRRAVAQLSLELEKEQNRTT 100 Q96BQ5 SYREALISQGRKLVEEKKLLEQERAQVMQEKRQVQPLRSAYLSCLQREENWQRRARLLLKEF-EAVLTERQNIYCSLFLPRSKRLEIEKSLLVRASVDPV 199 Q6PEB9 SFREALISQGRKLAEEKKLLEQERAQIIQEKSQRQPLRRAYLSCLEEEDEWQRRAQLVLKEVGEA-LEERQNIYCSLILPRSARQQLEKSLLVRTSADPV 199 Q96BQ5 AADLEMAAGLTDIFQHDTYCGDVWNTNKRQNGRLMWLYLKYWELVVELKKFKRVEEAILEK 260 Q6PEB9 AADLEMATGLSDIFKHDKHCGDVWNTNKRQNGKLMWMYLKYWELLVELKKFKKIEKVILGK 260
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 2. P | GO:0061617 | MICOS complex |
| 2. P | GO:0046933 | proton-transporting ATP synthase activity, rotational mechanism |
| 2. P | GO:1990429 | peroxisomal importomer complex |
| 2. P | GO:0110146 | magnetosome membrane |
| 2. P | GO:0044659 | viral release from host cell by cytolysis |
| 2. P | GO:0019076 | viral release from host cell |
| 2. P | GO:0016560 | protein import into peroxisome matrix, docking |
| 2. P | GO:0000779 | condensed chromosome, centromeric region |
| 2. P | GO:0033644 | host cell membrane |
| 2. P | GO:1990415 | |
| 2. P | GO:0031511 | Mis6-Sim4 complex |
| 2. P | GO:0045263 | proton-transporting ATP synthase complex, coupling factor F(o) |
| 2. P | GO:0140275 | MIB complex |
| 2. P | GO:0008053 | mitochondrial fusion |
| 2. P | GO:0051382 | kinetochore assembly |
| 2. P | GO:0007007 | inner mitochondrial membrane organization |
| 2. P | GO:0090680 | disruption by virus of host outer membrane |
| 2. P | GO:0000939 | inner kinetochore |
| 2. P | GO:0019835 | cytolysis |
| 2. P | GO:0042407 | cristae formation |
| 2. P | GO:0016021 | integral component of membrane |
| 2. P | GO:0009535 | chloroplast thylakoid membrane |
| 2. P | GO:0009536 | plastid |
| 2. P | GO:0140221 | pathogen-containing vacuole membrane |
| 2. P | GO:0020002 | host cell plasma membrane |
| 2. P | GO:0001401 | SAM complex |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | P0C267 | Coiled-coil domain-containing protein 127 | 0.00e+00 | 2.76e-63 | 1.61e-164 |
| 1. PB | Q3TC33 | Coiled-coil domain-containing protein 127 | 0.00e+00 | 1.91e-54 | 2.44e-163 |
| 1. PB | Q96BQ5 | Coiled-coil domain-containing protein 127 | 0 | 6.11e-132 | 0.0 |
| 1. PB | Q6PEB9 | Coiled-coil domain-containing protein 127 | 0.00e+00 | 1.74e-49 | 5.48e-158 |
| 2. P | Q09X31 | ATP synthase subunit b, chloroplastic | 9.13e-07 | 3.92e-03 | NA |
| 2. P | A0ZZ21 | ATP synthase subunit b, chloroplastic | 5.97e-07 | 1.10e-02 | NA |
| 2. P | P10305 | Spanin, inner membrane subunit | NA | 3.79e-05 | NA |
| 2. P | A5FVI7 | ATP synthase subunit b 1 | 4.50e-08 | 1.30e-02 | NA |
| 2. P | A8KB59 | Coiled-coil domain-containing protein 153 | 9.46e-09 | 1.98e-02 | NA |
| 2. P | Q0RDB0 | ATP synthase subunit b | 3.32e-07 | 3.05e-02 | NA |
| 2. P | Q09FX5 | ATP synthase subunit b, chloroplastic | 3.35e-07 | 9.33e-03 | NA |
| 2. P | A4QJI5 | ATP synthase subunit b, chloroplastic | 1.63e-07 | 1.65e-02 | NA |
| 2. P | P03803 | Spanin, inner membrane subunit | NA | 6.58e-05 | NA |
| 2. P | B2XWN5 | ATP synthase subunit b, chloroplastic | 4.21e-08 | 1.13e-02 | NA |
| 2. P | O62939 | ATP synthase subunit b, chloroplastic | 1.81e-08 | 2.53e-03 | NA |
| 2. P | Q2MIB4 | ATP synthase subunit b, chloroplastic | 1.27e-07 | 3.32e-03 | NA |
| 2. P | Q3BAQ6 | ATP synthase subunit b, chloroplastic | 1.58e-07 | 2.25e-02 | NA |
| 2. P | Q4A8W3 | ATP synthase subunit b | 5.78e-09 | 1.98e-02 | NA |
| 2. P | Q601Z9 | ATP synthase subunit b | 8.81e-08 | 2.99e-02 | NA |
| 2. P | P27358 | Spanin, inner membrane subunit | NA | 6.45e-03 | NA |
| 2. P | Q2YMC4 | ATP synthase subunit b 2 | 2.69e-07 | 4.57e-02 | NA |
| 2. P | Q1KXW6 | ATP synthase subunit b, chloroplastic | 2.82e-06 | 1.01e-03 | NA |
| 2. P | Q5EAJ6 | Inhibitor of nuclear factor kappa-B kinase-interacting protein | 9.78e-05 | 1.52e-02 | NA |
| 2. P | B1A921 | ATP synthase subunit b, chloroplastic | 7.21e-07 | 3.59e-03 | NA |
| 2. P | P0C2Z0 | ATP synthase subunit b, chloroplastic | 1.30e-08 | 3.96e-03 | NA |
| 2. P | A1E9S0 | ATP synthase subunit b, chloroplastic | 1.67e-08 | 5.61e-04 | NA |
| 2. P | A4QK04 | ATP synthase subunit b, chloroplastic | 7.48e-07 | 2.40e-02 | NA |
| 2. P | Q2L8Z3 | ATP synthase subunit b, chloroplastic | 5.54e-07 | 1.10e-02 | NA |
| 2. P | P38477 | ATP synthase protein MI25 | 1.14e-07 | 1.88e-05 | NA |
| 2. P | Q06GS4 | ATP synthase subunit b, chloroplastic | 7.16e-09 | 3.79e-02 | NA |
| 2. P | Q06J69 | ATP synthase subunit b, chloroplastic | 6.52e-08 | 1.16e-04 | NA |
| 2. P | Q27S64 | ATP synthase subunit b, chloroplastic | 1.50e-07 | 3.32e-03 | NA |
| 2. P | P30393 | ATP synthase subunit b, chloroplastic | 8.57e-08 | 4.70e-02 | NA |
| 2. P | P0C2Y9 | ATP synthase subunit b, chloroplastic | 1.49e-08 | 3.96e-03 | NA |
| 2. P | O64363 | Protein gp55 | NA | 5.28e-07 | NA |
| 2. P | Q6ENW7 | ATP synthase subunit b, chloroplastic | 2.48e-08 | 5.11e-04 | NA |
| 2. P | Q2PMS9 | ATP synthase subunit b, chloroplastic | 1.31e-08 | 3.85e-02 | NA |
| 2. P | Q12234 | GRIP domain-containing protein RUD3 | 6.13e-06 | 2.66e-02 | NA |
| 2. P | B3TN47 | ATP synthase subunit b, chloroplastic | 2.16e-08 | 9.87e-03 | NA |
| 2. P | B4YNF1 | Uncharacterized protein V11 | NA | 4.98e-03 | NA |
| 2. P | P00726 | Spanin, inner membrane subunit | NA | 2.17e-02 | NA |
| 2. P | Q6ENH8 | ATP synthase subunit b, chloroplastic | 1.25e-08 | 3.96e-03 | NA |
| 2. P | Q3C1H3 | ATP synthase subunit b, chloroplastic | 1.37e-07 | 3.63e-03 | NA |
| 2. P | A1EA04 | ATP synthase subunit b, chloroplastic | 3.30e-09 | 2.84e-03 | NA |
| 2. P | P0C156 | ATP synthase subunit b, chloroplastic | 3.22e-08 | 5.11e-04 | NA |
| 2. P | Q5UQW6 | Uncharacterized protein R387 | NA | 3.65e-04 | NA |
| 2. P | P75719 | Prophage Rz endopeptidase RzpD | 7.96e-09 | 2.66e-03 | NA |
| 2. P | Q8BMK4 | Cytoskeleton-associated protein 4 | 3.27e-06 | 4.78e-02 | NA |
| 2. P | A8SE63 | ATP synthase subunit b, chloroplastic | 7.82e-07 | 5.33e-03 | NA |
| 2. P | A4QJA1 | ATP synthase subunit b, chloroplastic | 6.58e-08 | 1.65e-02 | NA |
| 2. P | P0CI27 | Inclusion membrane protein A | 1.56e-05 | 2.23e-03 | NA |
| 2. P | B2XT88 | ATP synthase subunit b, chloroplastic | 1.90e-08 | 1.07e-02 | NA |
| 2. P | P76158 | Uncharacterized protein RzpQ | 1.29e-08 | 3.33e-09 | NA |
| 2. P | Q2MIK1 | ATP synthase subunit b, chloroplastic | 1.19e-07 | 3.32e-03 | NA |
| 2. P | Q2J6M9 | ATP synthase subunit b | 5.01e-07 | 9.16e-03 | NA |
| 2. P | B0CK73 | ATP synthase subunit b 2 | 2.69e-07 | 3.28e-02 | NA |
| 2. P | A0A321 | ATP synthase subunit b, chloroplastic | 5.71e-07 | 4.57e-03 | NA |
| 2. P | P13583 | Spanin, inner membrane subunit | NA | 3.55e-02 | NA |
| 2. P | P56759 | ATP synthase subunit b, chloroplastic | 1.43e-07 | 7.80e-03 | NA |
| 2. P | A1E9I7 | ATP synthase subunit b, chloroplastic | 2.84e-08 | 8.57e-03 | NA |
| 2. P | Q56P07 | ATP synthase subunit b, chloroplastic | 1.13e-06 | 3.66e-03 | NA |
| 2. P | P0C7Q1 | Coiled-coil domain-containing protein 153 | 1.26e-08 | 2.71e-02 | NA |
| 2. P | B2XTP4 | ATP synthase subunit b, chloroplastic | 1.43e-08 | 1.07e-02 | NA |
| 2. P | Q8S8Y2 | ATP synthase subunit b, chloroplastic | 6.50e-07 | 3.16e-02 | NA |
| 2. P | A7Y3A6 | ATP synthase subunit b, chloroplastic | 7.82e-08 | 1.49e-03 | NA |
| 2. P | P48186 | ATP synthase subunit b, chloroplastic | 2.17e-08 | 1.94e-03 | NA |
| 2. P | Q4AAW1 | ATP synthase subunit b | 3.17e-07 | 4.65e-02 | NA |
| 2. P | A4QLI0 | ATP synthase subunit b, chloroplastic | 6.58e-07 | 1.65e-02 | NA |
| 2. P | A0A0H3MD02 | Inclusion membrane protein A | 3.78e-06 | 9.48e-04 | NA |
| 2. P | A4QKH8 | ATP synthase subunit b, chloroplastic | 2.01e-07 | 2.78e-02 | NA |
| 2. P | Q0G9X6 | ATP synthase subunit b, chloroplastic | 1.89e-07 | 2.02e-03 | NA |
| 2. P | A4QK91 | ATP synthase subunit b, chloroplastic | 3.22e-07 | 8.57e-03 | NA |
| 2. P | Q6KI77 | ATP synthase subunit b | 2.87e-08 | 3.19e-02 | NA |
| 2. P | A4GGB1 | ATP synthase subunit b, chloroplastic | 5.48e-07 | 4.74e-02 | NA |
| 2. P | A4QKR7 | ATP synthase subunit b, chloroplastic | 9.60e-08 | 4.95e-02 | NA |
| 2. P | O34460 | Sporulation membrane protein YtrI | 4.50e-04 | 3.16e-02 | NA |
| 2. P | Q7YJY3 | ATP synthase subunit b, chloroplastic | 8.19e-07 | 1.83e-02 | NA |
| 2. P | Q33C52 | ATP synthase subunit b, chloroplastic | 6.25e-07 | 1.22e-03 | NA |
| 2. P | Q6EW62 | ATP synthase subunit b, chloroplastic | 2.64e-08 | 2.29e-03 | NA |
| 2. P | A6WW80 | ATP synthase subunit b 2 | 3.74e-07 | 3.92e-02 | NA |
| 2. P | Q9XJJ6 | Spanin, inner membrane subunit | NA | 1.61e-03 | NA |
| 2. P | Q4VZP7 | ATP synthase subunit b, chloroplastic | 1.88e-07 | 1.79e-03 | NA |
| 2. P | A7HQY4 | ATP synthase subunit b 1 | 4.54e-07 | 4.87e-02 | NA |
| 2. P | A8W3B0 | ATP synthase subunit b, chloroplastic | 5.26e-08 | 8.41e-03 | NA |
| 2. P | Q06H11 | ATP synthase subunit b, chloroplastic | 1.37e-07 | 4.30e-04 | NA |
| 2. P | B5LMN0 | ATP synthase subunit b, chloroplastic | 3.98e-07 | 2.94e-02 | NA |
| 2. P | A6H5F2 | ATP synthase subunit b, chloroplastic | 1.60e-08 | 7.99e-04 | NA |
| 2. P | B2S9N1 | ATP synthase subunit b 2 | 3.06e-07 | 4.57e-02 | NA |
| 2. P | Q0P3K6 | ATP synthase subunit b, chloroplastic | 4.66e-07 | 3.55e-02 | NA |
| 2. P | Q85WS7 | ATP synthase subunit b, chloroplastic | 8.52e-11 | 6.27e-03 | NA |
| 2. P | A4QL92 | ATP synthase subunit b, chloroplastic | 1.51e-06 | 6.02e-04 | NA |
| 2. P | A4QLR9 | ATP synthase subunit b, chloroplastic | 1.90e-07 | 1.52e-02 | NA |
| 2. P | B2LMI6 | ATP synthase subunit b, chloroplastic | 4.42e-06 | 1.40e-02 | NA |
| 2. P | P0C2Y8 | ATP synthase subunit b, chloroplastic | 2.05e-08 | 3.96e-03 | NA |
| 2. P | P44773 | Uncharacterized protein HI_0603 | 2.14e-07 | 1.67e-03 | NA |
| 2. P | P40155 | Peroxisomal membrane protein PEX17 | 9.10e-06 | 8.73e-03 | NA |
| 2. P | Q06RE5 | ATP synthase subunit b, chloroplastic | 3.43e-06 | 4.23e-03 | NA |
| 2. P | P0DPS5 | Inclusion membrane protein A | 2.59e-06 | 3.26e-04 | NA |
| 2. P | P08214 | ATP synthase subunit b, chloroplastic | 1.80e-09 | 7.16e-03 | NA |
| 2. P | Q9BBS4 | ATP synthase subunit b, chloroplastic | 1.80e-07 | 1.87e-03 | NA |
| 2. P | Q5UR51 | Uncharacterized protein R566 | NA | 7.30e-03 | NA |
| 2. P | V6F5F3 | Liposome tubulation protein MamY | 8.98e-06 | 1.59e-06 | NA |
| 2. P | Q9JGU0 | Phosphoprotein | NA | 7.16e-03 | NA |
| 2. P | A4QJR9 | ATP synthase subunit b, chloroplastic | 5.62e-07 | 7.95e-03 | NA |
| 2. P | Q06FX5 | ATP synthase subunit b, chloroplastic | 4.68e-08 | 1.53e-03 | NA |
| 2. P | A5VNW5 | ATP synthase subunit b 2 | 2.63e-07 | 2.63e-02 | NA |
| 2. P | Q1AVH5 | ATP synthase subunit b | 1.29e-08 | 3.10e-02 | NA |
| 2. P | B2Y1W1 | ATP synthase subunit b, chloroplastic | 4.83e-09 | 1.88e-02 | NA |
| 2. P | Q2W8K3 | Liposome tubulation protein MamY | 2.65e-06 | 2.38e-02 | NA |
| 2. P | Q0G9N3 | ATP synthase subunit b, chloroplastic | 7.12e-07 | 7.95e-03 | NA |
| 2. P | D6YXE8 | Inclusion membrane protein A | 4.80e-06 | 2.23e-03 | NA |
| 2. P | P06290 | ATP synthase subunit b, chloroplastic | 2.61e-08 | 1.60e-02 | NA |
| 2. P | A9L982 | ATP synthase subunit b, chloroplastic | 5.25e-08 | 2.49e-02 | NA |
| 2. P | A1XGM4 | ATP synthase subunit b, chloroplastic | 1.06e-07 | 4.23e-03 | NA |
| 2. P | Q70XU9 | ATP synthase subunit b, chloroplastic | 1.35e-09 | 6.03e-03 | NA |
| 2. P | Q9NX63 | MICOS complex subunit MIC19 | 3.12e-08 | 4.74e-02 | NA |
| 2. P | O94494 | Inner kinetochore subunit sim4 | 3.11e-06 | 1.06e-02 | NA |
| 2. P | A8Y9G6 | ATP synthase subunit b, chloroplastic | 2.57e-08 | 8.57e-03 | NA |
| 2. P | A4QL05 | ATP synthase subunit b, chloroplastic | 3.73e-07 | 1.38e-02 | NA |
| 2. P | P06528 | ATP synthase subunit b, chloroplastic | 1.23e-08 | 8.57e-03 | NA |
| 2. P | A6MMJ3 | ATP synthase subunit b, chloroplastic | 1.08e-06 | 3.72e-02 | NA |