Summary
Structures and Sequence Alignment
The best structural homolog that predicted by 1. PB was
Q8BLS7
(Ankyrin repeat domain-containing protein SOWAHA) with a FATCAT P-Value: 1.89e-08 and RMSD of 5.72 angstrom. The sequence alignment identity is 76.7%.
Structural alignment shown in left. Query protein Q2M3V2 colored as red in alignment, homolog Q8BLS7 colored as blue.
Query protein Q2M3V2 is also shown in right top, homolog Q8BLS7 showed in right bottom. They are colored based on secondary structures.
Q2M3V2 MAL--AAAAAAAAAGVSQAAVLGFLQEHGGKVRNSELLSRFKPLLDAGDPRGRAARRDRFKQFVNNVAVVKELDGVKFVVLRKKPRPPE-PE-PAPFGP- 95 Q8BLS7 MALAAAAAAAAAAAGVSQAAVLGFLREHGGQVRNSELLSRFKPLLDAGDPRGRAARRDRFKQFVNNVAVVKELDGVKFVVLRKKPRPPEGPEAPLPSSPG 100 Q2M3V2 -PGAAAQPSKPTSTVLP-RSASAPGAPPLVRVP-RPVEPPGDLGLPTEPQDTP----------GGPA-SEPAQPPGERSADPPLPALELAQATERPSADA 181 Q8BLS7 VPAALAQ-----CAAVPAEDNCAPGAP---HSPQRSGEPPEDSSAPSELQHTPETLPSEVTQVEAPSGSAP-QPGG--PEDPALP---------R-SSEL 179 Q2M3V2 APPPRAPSEAASPCSDPPDAEPGPGAAKGPPQQKPCMLPVRC-VPAPATLRLRAEEPGLRRQLSEEPSPRSSPLLLRRLSVEESGLGLGLGPGRSPHLRR 280 Q8BLS7 ARPASVPSGLALTSTESPGPEPAPPTAQVPP-QKPCMLPVRCVVPGPAALRIRAEEQGLRRQRSEEPSPRGSPMLLRRLSVEESGLGLHLGPGRSPHLRR 278 Q2M3V2 LSRAGPRLLSPDAEELPAAPPPS-AVPLEPSEHEWLVRTAGGRWTHQLHGLLLRDRGLAAKRDFMSGFTALHWAAKSGDGEMALQLVEVARRSGAPVDVN 379 Q8BLS7 LSRAGPRLLSPDTEEMPVAPLPSPAVPLEPTEHEWLVRTASGRWSHQLHGLLLRDRGLAAKRDFMSGFTALHWAAKNGDREMALQLVEVARRGGAPVDVN 378 Q2M3V2 ARSHGGYTPLHLAALHGHEDAAVLLVVRLGAQVHVRDHSGRRAYQYLRPGSSYALRRLLGDPGLRGTTEPDATGGGSGSLAARRPVQVAATILSSTTSAF 479 Q8BLS7 ARSHGGYTPLHLAALHGHEDAAVLLVVRLGAQVHVRDYSGRRAYQYLRPGSSYALRRLLGDPGLRSMMEPDAASGGSGSLVSRHPVQVAATILSSTTSAF 478 Q2M3V2 LGVLADDLMLQDLARGLKKSSSFSKFLSASPMAPRKKTKIRGGLPAFSEISRRPTPGPLAGLVPSFPPTT 549 Q8BLS7 LGVLADDLMLQDLARGLKKSSSFSKFLGASPMAPRKKTKIRGGLPSFTEISHRSTPGPLAGLVPSLPPPT 548
Go Annotations
1. PB indicates the go terms that are found by both PROST and BLAST.2. P indicates the go terms that are found by only PROST.
3. B indicates the go terms that are only annotated by BLAST.
| Source | GO | Description |
|---|---|---|
| 1. PB | GO:0031594 | neuromuscular junction |
| 1. PB | GO:0044030 | regulation of DNA methylation |
| 1. PB | GO:0036464 | cytoplasmic ribonucleoprotein granule |
| 1. PB | GO:0007253 | cytoplasmic sequestering of NF-kappaB |
| 1. PB | GO:0031436 | BRCA1-BARD1 complex |
| 2. P | GO:0045611 | negative regulation of hemocyte differentiation |
| 2. P | GO:0006954 | inflammatory response |
| 2. P | GO:0003682 | chromatin binding |
| 2. P | GO:0009953 | dorsal/ventral pattern formation |
| 2. P | GO:0090309 | positive regulation of DNA methylation-dependent heterochromatin assembly |
| 2. P | GO:0050729 | positive regulation of inflammatory response |
| 2. P | GO:0045892 | negative regulation of transcription, DNA-templated |
| 2. P | GO:2000321 | positive regulation of T-helper 17 cell differentiation |
| 2. P | GO:0071212 | subsynaptic reticulum |
| 2. P | GO:0007399 | nervous system development |
| 2. P | GO:0009950 | dorsal/ventral axis specification |
| 2. P | GO:0000786 | nucleosome |
| 2. P | GO:0046843 | dorsal appendage formation |
| 2. P | GO:0051059 | NF-kappaB binding |
| 2. P | GO:0045597 | positive regulation of cell differentiation |
| 2. P | GO:0000792 | heterochromatin |
| 2. P | GO:0050852 | T cell receptor signaling pathway |
| 2. P | GO:0045751 | negative regulation of Toll signaling pathway |
| 2. P | GO:0005634 | nucleus |
| 2. P | GO:0010468 | regulation of gene expression |
| 2. P | GO:0045814 | negative regulation of gene expression, epigenetic |
| 2. P | GO:0045869 | negative regulation of single stranded viral RNA replication via double stranded DNA intermediate |
| 2. P | GO:0016607 | nuclear speck |
| 2. P | GO:0002789 | negative regulation of antifungal peptide production |
| 2. P | GO:0048477 | oogenesis |
| 2. P | GO:0035064 | methylated histone binding |
| 2. P | GO:0019730 | antimicrobial humoral response |
| 2. P | GO:2000812 | regulation of barbed-end actin filament capping |
| 3. B | GO:1903356 | positive regulation of distal tip cell migration |
| 3. B | GO:0071286 | cellular response to magnesium ion |
| 3. B | GO:0043198 | dendritic shaft |
| 3. B | GO:0050775 | positive regulation of dendrite morphogenesis |
| 3. B | GO:0045111 | intermediate filament cytoskeleton |
| 3. B | GO:0090037 | positive regulation of protein kinase C signaling |
| 3. B | GO:0048709 | oligodendrocyte differentiation |
| 3. B | GO:0043034 | costamere |
| 3. B | GO:0032791 | lead ion binding |
| 3. B | GO:0031297 | replication fork processing |
| 3. B | GO:1903779 | regulation of cardiac conduction |
| 3. B | GO:0016567 | protein ubiquitination |
| 3. B | GO:0036166 | phenotypic switching |
| 3. B | GO:0046469 | platelet activating factor metabolic process |
| 3. B | GO:0001756 | somitogenesis |
| 3. B | GO:0032421 | stereocilium bundle |
| 3. B | GO:0039022 | pronephric duct development |
| 3. B | GO:2001259 | positive regulation of cation channel activity |
| 3. B | GO:0021514 | ventral spinal cord interneuron differentiation |
| 3. B | GO:1903522 | regulation of blood circulation |
| 3. B | GO:0045663 | positive regulation of myoblast differentiation |
| 3. B | GO:0018105 | peptidyl-serine phosphorylation |
| 3. B | GO:0019731 | antibacterial humoral response |
| 3. B | GO:0014044 | Schwann cell development |
| 3. B | GO:0006306 | DNA methylation |
| 3. B | GO:0106310 | protein serine kinase activity |
| 3. B | GO:0046974 | histone methyltransferase activity (H3-K9 specific) |
| 3. B | GO:0098908 | regulation of neuronal action potential |
| 3. B | GO:0018024 | histone-lysine N-methyltransferase activity |
| 3. B | GO:0085020 | protein K6-linked ubiquitination |
| 3. B | GO:0004842 | ubiquitin-protein transferase activity |
| 3. B | GO:0047499 | calcium-independent phospholipase A2 activity |
| 3. B | GO:0030018 | Z disc |
| 3. B | GO:0048259 | regulation of receptor-mediated endocytosis |
| 3. B | GO:0097431 | mitotic spindle pole |
| 3. B | GO:0003950 | NAD+ ADP-ribosyltransferase activity |
| 3. B | GO:0032956 | regulation of actin cytoskeleton organization |
| 3. B | GO:0036372 | opsin transport |
| 3. B | GO:0035264 | multicellular organism growth |
| 3. B | GO:0021519 | spinal cord association neuron specification |
| 3. B | GO:0021536 | diencephalon development |
| 3. B | GO:0036377 | arbuscular mycorrhizal association |
| 3. B | GO:0031116 | positive regulation of microtubule polymerization |
| 3. B | GO:0046473 | phosphatidic acid metabolic process |
| 3. B | GO:0045737 | positive regulation of cyclin-dependent protein serine/threonine kinase activity |
| 3. B | GO:0099612 | protein localization to axon |
| 3. B | GO:0045669 | positive regulation of osteoblast differentiation |
| 3. B | GO:0005524 | ATP binding |
| 3. B | GO:0034968 | histone lysine methylation |
| 3. B | GO:0016571 | histone methylation |
| 3. B | GO:0046338 | phosphatidylethanolamine catabolic process |
| 3. B | GO:0101026 | mitotic nuclear membrane biogenesis |
| 3. B | GO:0010765 | positive regulation of sodium ion transport |
| 3. B | GO:0070588 | calcium ion transmembrane transport |
| 3. B | GO:0035304 | regulation of protein dephosphorylation |
| 3. B | GO:0018027 | peptidyl-lysine dimethylation |
| 3. B | GO:0061551 | trigeminal ganglion development |
| 3. B | GO:0035690 | |
| 3. B | GO:0010960 | magnesium ion homeostasis |
| 3. B | GO:0008542 | visual learning |
| 3. B | GO:0072659 | protein localization to plasma membrane |
| 3. B | GO:0086015 | SA node cell action potential |
| 3. B | GO:0015267 | channel activity |
| 3. B | GO:0102568 | |
| 3. B | GO:1990404 | protein ADP-ribosylase activity |
| 3. B | GO:0042325 | regulation of phosphorylation |
| 3. B | GO:0016328 | lateral plasma membrane |
| 3. B | GO:0007520 | myoblast fusion |
| 3. B | GO:0003151 | outflow tract morphogenesis |
| 3. B | GO:0021675 | nerve development |
| 3. B | GO:0002039 | p53 binding |
| 3. B | GO:0000281 | mitotic cytokinesis |
| 3. B | GO:0001841 | neural tube formation |
| 3. B | GO:0048899 | anterior lateral line development |
| 3. B | GO:0001222 | transcription corepressor binding |
| 3. B | GO:0007009 | plasma membrane organization |
| 3. B | GO:0043292 | contractile fiber |
| 3. B | GO:0070417 | cellular response to cold |
| 3. B | GO:0010564 | regulation of cell cycle process |
| 3. B | GO:0070212 | protein poly-ADP-ribosylation |
| 3. B | GO:1904058 | positive regulation of sensory perception of pain |
| 3. B | GO:0018026 | peptidyl-lysine monomethylation |
| 3. B | GO:0007160 | cell-matrix adhesion |
| 3. B | GO:0032426 | stereocilium tip |
| 3. B | GO:0043409 | negative regulation of MAPK cascade |
| 3. B | GO:0043008 | ATP-dependent protein binding |
| 3. B | GO:0019228 | neuronal action potential |
| 3. B | GO:0005654 | nucleoplasm |
| 3. B | GO:0021555 | midbrain-hindbrain boundary morphogenesis |
| 3. B | GO:0086046 | membrane depolarization during SA node cell action potential |
| 3. B | GO:0051569 | regulation of histone H3-K4 methylation |
| 3. B | GO:0004622 | lysophospholipase activity |
| 3. B | GO:0007005 | mitochondrion organization |
| 3. B | GO:0072357 | PTW/PP1 phosphatase complex |
| 3. B | GO:0009925 | basal plasma membrane |
| 3. B | GO:0009932 | cell tip growth |
| 3. B | GO:0043086 | negative regulation of catalytic activity |
| 3. B | GO:0022011 | myelination in peripheral nervous system |
| 3. B | GO:0010650 | positive regulation of cell communication by electrical coupling |
| 3. B | GO:0010313 | phytochrome binding |
| 3. B | GO:0097546 | ciliary base |
| 3. B | GO:0000209 | protein polyubiquitination |
| 3. B | GO:0001947 | heart looping |
| 3. B | GO:0090201 | negative regulation of release of cytochrome c from mitochondria |
| 3. B | GO:0002027 | regulation of heart rate |
| 3. B | GO:0010638 | positive regulation of organelle organization |
| 3. B | GO:0005178 | integrin binding |
| 3. B | GO:2000178 | negative regulation of neural precursor cell proliferation |
| 3. B | GO:0044325 | transmembrane transporter binding |
| 3. B | GO:0008593 | regulation of Notch signaling pathway |
| 3. B | GO:0006897 | endocytosis |
| 3. B | GO:0070650 | actin filament bundle distribution |
| 3. B | GO:0098904 | regulation of AV node cell action potential |
| 3. B | GO:0072116 | pronephros formation |
| 3. B | GO:1901339 | regulation of store-operated calcium channel activity |
| 3. B | GO:0006887 | exocytosis |
| 3. B | GO:0071314 | cellular response to cocaine |
| 3. B | GO:0000242 | pericentriolar material |
| 3. B | GO:1990760 | osmolarity-sensing cation channel activity |
| 3. B | GO:0045787 | positive regulation of cell cycle |
| 3. B | GO:0046875 | ephrin receptor binding |
| 3. B | GO:0010366 | negative regulation of ethylene biosynthetic process |
| 3. B | GO:0046826 | negative regulation of protein export from nucleus |
| 3. B | GO:1900246 | positive regulation of RIG-I signaling pathway |
| 3. B | GO:1904901 | positive regulation of myosin II filament organization |
| 3. B | GO:0098907 | regulation of SA node cell action potential |
| 3. B | GO:0003408 | optic cup formation involved in camera-type eye development |
| 3. B | GO:1900026 | positive regulation of substrate adhesion-dependent cell spreading |
| 3. B | GO:0035965 | cardiolipin acyl-chain remodeling |
| 3. B | GO:0001568 | blood vessel development |
| 3. B | GO:0030155 | regulation of cell adhesion |
| 3. B | GO:0086014 | atrial cardiac muscle cell action potential |
| 3. B | GO:0016409 | palmitoyltransferase activity |
| 3. B | GO:0035774 | positive regulation of insulin secretion involved in cellular response to glucose stimulus |
| 3. B | GO:0051289 | protein homotetramerization |
| 3. B | GO:0046957 | negative phototaxis |
| 3. B | GO:0097604 | temperature-gated cation channel activity |
| 3. B | GO:0070213 | protein auto-ADP-ribosylation |
| 3. B | GO:0004672 | protein kinase activity |
| 3. B | GO:0051973 | positive regulation of telomerase activity |
| 3. B | GO:0030507 | spectrin binding |
| 3. B | GO:0043518 | negative regulation of DNA damage response, signal transduction by p53 class mediator |
| 3. B | GO:0010923 | negative regulation of phosphatase activity |
| 3. B | GO:0099523 | presynaptic cytosol |
| 3. B | GO:0048812 | neuron projection morphogenesis |
| 3. B | GO:0033292 | T-tubule organization |
| 3. B | GO:1904908 | negative regulation of maintenance of mitotic sister chromatid cohesion, telomeric |
| 3. B | GO:0051117 | ATPase binding |
| 3. B | GO:0070682 | proteasome regulatory particle assembly |
| 3. B | GO:1900245 | positive regulation of MDA-5 signaling pathway |
| 3. B | GO:0031143 | pseudopodium |
| 3. B | GO:0051017 | actin filament bundle assembly |
| 3. B | GO:1900087 | positive regulation of G1/S transition of mitotic cell cycle |
| 3. B | GO:0048148 | behavioral response to cocaine |
| 3. B | GO:0071244 | cellular response to carbon dioxide |
| 3. B | GO:0009566 | fertilization |
| 3. B | GO:0106311 | |
| 3. B | GO:0014832 | urinary bladder smooth muscle contraction |
| 3. B | GO:0071889 | 14-3-3 protein binding |
| 3. B | GO:0014069 | postsynaptic density |
| 3. B | GO:0043406 | positive regulation of MAP kinase activity |
| 3. B | GO:0001954 | positive regulation of cell-matrix adhesion |
| 3. B | GO:0051726 | regulation of cell cycle |
| 3. B | GO:0035844 | cloaca development |
| 3. B | GO:0014912 | negative regulation of smooth muscle cell migration |
| 3. B | GO:0032436 | positive regulation of proteasomal ubiquitin-dependent protein catabolic process |
| 3. B | GO:0006469 | negative regulation of protein kinase activity |
| 3. B | GO:1904855 | proteasome regulatory particle binding |
| 3. B | GO:0030307 | positive regulation of cell growth |
| 3. B | GO:0099092 | postsynaptic density, intracellular component |
| 3. B | GO:0045211 | postsynaptic membrane |
| 3. B | GO:0014070 | response to organic cyclic compound |
| 3. B | GO:1902412 | regulation of mitotic cytokinesis |
| 3. B | GO:0043266 | regulation of potassium ion transport |
| 3. B | GO:0050955 | thermoception |
| 3. B | GO:0030017 | sarcomere |
| 3. B | GO:1902902 | negative regulation of autophagosome assembly |
| 3. B | GO:0043491 | protein kinase B signaling |
| 3. B | GO:0050772 | positive regulation of axonogenesis |
| 3. B | GO:0016055 | Wnt signaling pathway |
| 3. B | GO:2000651 | positive regulation of sodium ion transmembrane transporter activity |
| 3. B | GO:0051967 | negative regulation of synaptic transmission, glutamatergic |
| 3. B | GO:0007080 | mitotic metaphase plate congression |
| 3. B | GO:0048815 | hermaphrodite genitalia morphogenesis |
| 3. B | GO:0061195 | taste bud formation |
| 3. B | GO:0031398 | positive regulation of protein ubiquitination |
| 3. B | GO:0018345 | protein palmitoylation |
| 3. B | GO:0032288 | myelin assembly |
| 3. B | GO:0140031 | phosphorylation-dependent protein binding |
| 3. B | GO:0001934 | positive regulation of protein phosphorylation |
| 3. B | GO:0086091 | regulation of heart rate by cardiac conduction |
| 3. B | GO:1900140 | regulation of seedling development |
| 3. B | GO:0048705 | skeletal system morphogenesis |
| 3. B | GO:2000304 | positive regulation of ceramide biosynthetic process |
| 3. B | GO:0031670 | cellular response to nutrient |
| 3. B | GO:0019208 | phosphatase regulator activity |
| 3. B | GO:0030315 | T-tubule |
| 3. B | GO:0055117 | regulation of cardiac muscle contraction |
| 3. B | GO:0034451 | centriolar satellite |
| 3. B | GO:0007409 | axonogenesis |
| 3. B | GO:0090263 | positive regulation of canonical Wnt signaling pathway |
| 3. B | GO:0000502 | proteasome complex |
| 3. B | GO:1902260 | negative regulation of delayed rectifier potassium channel activity |
| 3. B | GO:0031013 | troponin I binding |
| 3. B | GO:0031430 | M band |
| 3. B | GO:0045995 | regulation of embryonic development |
| 3. B | GO:0070198 | protein localization to chromosome, telomeric region |
| 3. B | GO:0090238 | positive regulation of arachidonic acid secretion |
| 3. B | GO:0005262 | calcium channel activity |
| 3. B | GO:0010761 | fibroblast migration |
| 3. B | GO:0017020 | myosin phosphatase regulator activity |
| 3. B | GO:0102545 | phosphatidyl phospholipase B activity |
| 3. B | GO:0097062 | dendritic spine maintenance |
| 3. B | GO:0031672 | A band |
| 3. B | GO:0045838 | positive regulation of membrane potential |
| 3. B | GO:0005929 | cilium |
| 3. B | GO:0098910 | regulation of atrial cardiac muscle cell action potential |
| 3. B | GO:0036371 | protein localization to T-tubule |
| 3. B | GO:0043194 | axon initial segment |
| 3. B | GO:0048662 | negative regulation of smooth muscle cell proliferation |
| 3. B | GO:0099527 | postsynapse to nucleus signaling pathway |
| 3. B | GO:0033309 | SBF transcription complex |
| 3. B | GO:0070742 | C2H2 zinc finger domain binding |
| 3. B | GO:0048265 | response to pain |
| 3. B | GO:0016279 | protein-lysine N-methyltransferase activity |
| 3. B | GO:0043066 | negative regulation of apoptotic process |
| 3. B | GO:0007613 | memory |
| 3. B | GO:0007165 | signal transduction |
| 3. B | GO:0010424 | DNA methylation on cytosine within a CG sequence |
| 3. B | GO:1904355 | positive regulation of telomere capping |
| 3. B | GO:0014731 | spectrin-associated cytoskeleton |
| 3. B | GO:0033270 | paranode region of axon |
| 3. B | GO:0005737 | cytoplasm |
| 3. B | GO:0098978 | glutamatergic synapse |
| 3. B | GO:0072114 | pronephros morphogenesis |
| 3. B | GO:0045184 | establishment of protein localization |
| 3. B | GO:0017124 | SH3 domain binding |
| 3. B | GO:0003847 | 1-alkyl-2-acetylglycerophosphocholine esterase activity |
| 3. B | GO:0010882 | regulation of cardiac muscle contraction by calcium ion signaling |
| 3. B | GO:0016323 | basolateral plasma membrane |
| 3. B | GO:2001257 | regulation of cation channel activity |
| 3. B | GO:0098871 | postsynaptic actin cytoskeleton |
| 3. B | GO:0097435 | supramolecular fiber organization |
| 3. B | GO:0046822 | regulation of nucleocytoplasmic transport |
| 3. B | GO:0097120 | receptor localization to synapse |
| 3. B | GO:0014704 | intercalated disc |
| 3. B | GO:0007098 | centrosome cycle |
| 3. B | GO:0019901 | protein kinase binding |
| 3. B | GO:0001955 | blood vessel maturation |
| 3. B | GO:0030907 | MBF transcription complex |
| 3. B | GO:0007219 | Notch signaling pathway |
| 3. B | GO:0010288 | response to lead ion |
| 3. B | GO:0001658 | branching involved in ureteric bud morphogenesis |
| 3. B | GO:0017171 | serine hydrolase activity |
| 3. B | GO:0009610 | response to symbiotic fungus |
| 3. B | GO:0035265 | organ growth |
| 3. B | GO:0010881 | regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion |
| 3. B | GO:0031441 | negative regulation of mRNA 3'-end processing |
| 3. B | GO:0034638 | phosphatidylcholine catabolic process |
| 3. B | GO:0042383 | sarcolemma |
| 3. B | GO:0021546 | rhombomere development |
| 3. B | GO:0030030 | cell projection organization |
| 3. B | GO:0050931 | pigment cell differentiation |
| 3. B | GO:0043001 | Golgi to plasma membrane protein transport |
| 3. B | GO:0046976 | histone methyltransferase activity (H3-K27 specific) |
| 3. B | GO:0032212 | positive regulation of telomere maintenance via telomerase |
| 3. B | GO:0050960 | detection of temperature stimulus involved in thermoception |
| 3. B | GO:0007569 | cell aging |
| 3. B | GO:0002040 | sprouting angiogenesis |
| 3. B | GO:0007130 | synaptonemal complex assembly |
| 3. B | GO:0005856 | cytoskeleton |
| 3. B | GO:0001894 | tissue homeostasis |
| 3. B | GO:0060236 | regulation of mitotic spindle organization |
| 3. B | GO:0043195 | terminal bouton |
| 3. B | GO:0016529 | sarcoplasmic reticulum |
| 3. B | GO:0060325 | face morphogenesis |
| 3. B | GO:0051225 | spindle assembly |
| 3. B | GO:0099175 | regulation of postsynapse organization |
| 3. B | GO:0050968 | detection of chemical stimulus involved in sensory perception of pain |
| 3. B | GO:0007229 | integrin-mediated signaling pathway |
| 3. B | GO:0030034 | microvillar actin bundle assembly |
| 3. B | GO:1904743 | negative regulation of telomeric DNA binding |
| 3. B | GO:1900383 | regulation of synaptic plasticity by receptor localization to synapse |
| 3. B | GO:0072660 | maintenance of protein location in plasma membrane |
| 3. B | GO:0090314 | positive regulation of protein targeting to membrane |
| 3. B | GO:0009967 | positive regulation of signal transduction |
| 3. B | GO:0086004 | regulation of cardiac muscle cell contraction |
| 3. B | GO:0048013 | ephrin receptor signaling pathway |
| 3. B | GO:1901019 | regulation of calcium ion transmembrane transporter activity |
| 3. B | GO:0009409 | response to cold |
| 3. B | GO:0043197 | dendritic spine |
| 3. B | GO:0102991 | myristoyl-CoA hydrolase activity |
| 3. B | GO:0045162 | clustering of voltage-gated sodium channels |
| 3. B | GO:0010378 | temperature compensation of the circadian clock |
| 3. B | GO:0019233 | sensory perception of pain |
| 3. B | GO:0045197 | establishment or maintenance of epithelial cell apical/basal polarity |
| 3. B | GO:0048920 | posterior lateral line neuromast primordium migration |
| 3. B | GO:0033209 | tumor necrosis factor-mediated signaling pathway |
| 3. B | GO:0030027 | lamellipodium |
| 3. B | GO:0043065 | positive regulation of apoptotic process |
| 3. B | GO:0036309 | protein localization to M-band |
| 3. B | GO:0033268 | node of Ranvier |
| 3. B | GO:0048665 | neuron fate specification |
| 3. B | GO:0010171 | body morphogenesis |
| 3. B | GO:0090200 | positive regulation of release of cytochrome c from mitochondria |
| 3. B | GO:0043596 | nuclear replication fork |
| 3. B | GO:0035507 | regulation of myosin-light-chain-phosphatase activity |
| 3. B | GO:0034394 | protein localization to cell surface |
| 3. B | GO:0008092 | cytoskeletal protein binding |
| 3. B | GO:0071709 | membrane assembly |
| 3. B | GO:0086069 | bundle of His cell to Purkinje myocyte communication |
| 3. B | GO:0034446 | substrate adhesion-dependent cell spreading |
| 3. B | GO:0015278 | calcium-release channel activity |
| 3. B | GO:0051924 | regulation of calcium ion transport |
| 3. B | GO:0045921 | positive regulation of exocytosis |
| 3. B | GO:0042311 | vasodilation |
| 3. B | GO:0085042 | periarbuscular membrane |
| 3. B | GO:0060992 | response to fungicide |
| 3. B | GO:0016290 | palmitoyl-CoA hydrolase activity |
| 3. B | GO:0030673 | axolemma |
| 3. B | GO:0051928 | positive regulation of calcium ion transport |
| 3. B | GO:0034112 | positive regulation of homotypic cell-cell adhesion |
| 3. B | GO:0021508 | floor plate formation |
| 3. B | GO:0043679 | axon terminus |
| 3. B | GO:0051570 | regulation of histone H3-K9 methylation |
| 3. B | GO:0010033 | response to organic substance |
| 3. B | GO:0006471 | protein ADP-ribosylation |
| 3. B | GO:0070531 | BRCA1-A complex |
| 3. B | GO:0004857 | enzyme inhibitor activity |
| 3. B | GO:0086070 | SA node cell to atrial cardiac muscle cell communication |
| 3. B | GO:0005200 | structural constituent of cytoskeleton |
| 3. B | GO:1901018 | positive regulation of potassium ion transmembrane transporter activity |
| 3. B | GO:0048859 | formation of anatomical boundary |
| 3. B | GO:0060135 | maternal process involved in female pregnancy |
| 3. B | GO:0042327 | positive regulation of phosphorylation |
| 3. B | GO:0070972 | protein localization to endoplasmic reticulum |
| 3. B | GO:0043268 | positive regulation of potassium ion transport |
| 3. B | GO:0086066 | atrial cardiac muscle cell to AV node cell communication |
| 3. B | GO:1901021 | positive regulation of calcium ion transmembrane transporter activity |
| 3. B | GO:1901224 | positive regulation of NIK/NF-kappaB signaling |
| 3. B | GO:0016021 | integral component of membrane |
| 3. B | GO:0060035 | notochord cell development |
| 3. B | GO:0005925 | focal adhesion |
| 3. B | GO:0021654 | rhombomere boundary formation |
| 3. B | GO:0045685 | regulation of glial cell differentiation |
| 3. B | GO:0050966 | detection of mechanical stimulus involved in sensory perception of pain |
| 3. B | GO:0030513 | positive regulation of BMP signaling pathway |
| 3. B | GO:0051151 | negative regulation of smooth muscle cell differentiation |
| 3. B | GO:2001279 | regulation of unsaturated fatty acid biosynthetic process |
| 3. B | GO:0046872 | metal ion binding |
| 3. B | GO:0004861 | cyclin-dependent protein serine/threonine kinase inhibitor activity |
| 3. B | GO:0042281 | dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase activity |
| 3. B | GO:0055002 | striated muscle cell development |
| 3. B | GO:0097553 | calcium ion transmembrane import into cytosol |
| 3. B | GO:0035508 | positive regulation of myosin-light-chain-phosphatase activity |
| 3. B | GO:0007528 | neuromuscular junction development |
| 3. B | GO:0000062 | fatty-acyl-CoA binding |
| 3. B | GO:1900827 | positive regulation of membrane depolarization during cardiac muscle cell action potential |
| 3. B | GO:0048892 | lateral line nerve development |
| 3. B | GO:0032049 | cardiolipin biosynthetic process |
| 3. B | GO:0045807 | positive regulation of endocytosis |
| 3. B | GO:0098686 | hippocampal mossy fiber to CA3 synapse |
| 3. B | GO:0042326 | negative regulation of phosphorylation |
| 3. B | GO:0008093 | cytoskeletal anchor activity |
| 3. B | GO:0010667 | negative regulation of cardiac muscle cell apoptotic process |
| 3. B | GO:0102567 | |
| 3. B | GO:0019706 | protein-cysteine S-palmitoyltransferase activity |
| 3. B | GO:0048916 | posterior lateral line development |
| 3. B | GO:1903793 | positive regulation of anion transport |
| 3. B | GO:0021521 | ventral spinal cord interneuron specification |
| 3. B | GO:0005938 | cell cortex |
| 3. B | GO:0045773 | positive regulation of axon extension |
| 3. B | GO:1904357 | negative regulation of telomere maintenance via telomere lengthening |
| 3. B | GO:0032088 | negative regulation of NF-kappaB transcription factor activity |
| 3. B | GO:0030674 | protein-macromolecule adaptor activity |
Homologs
1. PB indicates the homologs that are found by both PROST and BLAST.
2. P indicates homologs that are only found by PROST.
3. B indicates homologs that are only found by BLAST.
| Source | Homolog | Description | FATCAT p-val | PROST Evalue | BLAST Evalue |
|---|---|---|---|---|---|
| 1. PB | Q8BZW2 | Ankyrin repeat domain-containing protein SOWAHB | 5.99e-02 | 1.20e-10 | 3.67e-34 |
| 1. PB | A6NEL2 | Ankyrin repeat domain-containing protein SOWAHB | 1.60e-02 | 1.78e-11 | 4.39e-34 |
| 1. PB | Q8BLS7 | Ankyrin repeat domain-containing protein SOWAHA | 1.89e-08 | 1.51e-99 | 0.0 |
| 1. PB | Q6NRK3 | Ankyrin repeat domain-containing protein SOWAHB | 3.66e-02 | 8.86e-13 | 1.56e-37 |
| 1. PB | Q53LP3 | Ankyrin repeat domain-containing protein SOWAHC | 6.60e-04 | 7.37e-35 | 4.59e-31 |
| 1. PB | Q8C0J6 | Ankyrin repeat domain-containing protein SOWAHC | 1.48e-04 | 8.61e-40 | 1.89e-06 |
| 1. PB | Q2M3V2 | Ankyrin repeat domain-containing protein SOWAHA | 0 | 5.52e-164 | 0.0 |
| 2. P | Q21209 | BRCA1-associated RING domain protein 1 | 3.58e-02 | 1.58e-02 | NA |
| 2. P | P83757 | NF-kappa-B inhibitor cactus | NA | 2.26e-04 | NA |
| 2. P | G3V8T1 | M-phase phosphoprotein 8 | 3.19e-02 | 4.35e-08 | NA |
| 2. P | G5EDE9 | ANK repeat-containing protein nipk-1 | 2.03e-01 | 4.39e-06 | NA |
| 2. P | Q99549 | M-phase phosphoprotein 8 | 1.92e-02 | 3.23e-07 | NA |
| 2. P | Q9BE45 | NF-kappa-B inhibitor zeta | 1.09e-02 | 1.77e-02 | NA |
| 2. P | Q03017 | NF-kappa-B inhibitor cactus | 1.17e-02 | 2.65e-05 | NA |
| 2. P | Q9BYH8 | NF-kappa-B inhibitor zeta | 9.30e-02 | 1.73e-03 | NA |
| 2. P | Q4KL97 | Ankyrin repeat domain-containing protein 1 | 1.57e-02 | 9.95e-04 | NA |
| 2. P | Q3TYA6 | M-phase phosphoprotein 8 | 3.60e-02 | 2.81e-08 | NA |
| 2. P | Q9EST8 | NF-kappa-B inhibitor zeta | 1.35e-02 | 3.89e-02 | NA |
| 2. P | Q05753 | Ankyrin repeat domain-containing protein, chloroplastic | 2.10e-02 | 3.66e-02 | NA |
| 3. B | Q9BGT9 | Ankyrin repeat and SOCS box protein 7 | 1.06e-04 | NA | 8.26e-07 |
| 3. B | Q9C0D5 | Protein TANC1 | 6.61e-01 | NA | 0.006 |
| 3. B | Q8N9V6 | Ankyrin repeat domain-containing protein 53 | 1.32e-02 | NA | 2.83e-04 |
| 3. B | Q00PJ1 | Cortactin-binding protein 2 | 2.09e-01 | NA | 5.90e-05 |
| 3. B | Q9Z1P7 | KN motif and ankyrin repeat domain-containing protein 3 | 1.47e-02 | NA | 4.68e-04 |
| 3. B | O70445 | BRCA1-associated RING domain protein 1 | 2.84e-02 | NA | 0.041 |
| 3. B | Q92527 | Ankyrin repeat domain-containing protein 7 | 3.60e-05 | NA | 6.86e-04 |
| 3. B | Q25338 | Delta-latroinsectotoxin-Lt1a | 1.93e-01 | NA | 0.006 |
| 3. B | Q80SY4 | E3 ubiquitin-protein ligase MIB1 | 5.14e-02 | NA | 0.023 |
| 3. B | Q0V8G2 | GA-binding protein subunit beta-2 | 1.33e-02 | NA | 0.020 |
| 3. B | Q02989 | Alpha-latroinsectotoxin-Lt1a (Fragment) | 2.92e-01 | NA | 0.011 |
| 3. B | P16157 | Ankyrin-1 | 7.90e-01 | NA | 0.006 |
| 3. B | O14974 | Protein phosphatase 1 regulatory subunit 12A | 4.49e-01 | NA | 7.38e-04 |
| 3. B | Q99NH0 | Ankyrin repeat domain-containing protein 17 | 5.57e-01 | NA | 0.009 |
| 3. B | Q337A0 | Probable E3 ubiquitin-protein ligase XBOS33 | 4.27e-02 | NA | 0.035 |
| 3. B | Q86YT6 | E3 ubiquitin-protein ligase MIB1 | 3.03e-01 | NA | 0.027 |
| 3. B | Q0VGY8 | Protein TANC1 | 5.15e-01 | NA | 0.003 |
| 3. B | B2RXR6 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B | 4.99e-02 | NA | 0.002 |
| 3. B | Q502K3 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C | 3.21e-02 | NA | 0.011 |
| 3. B | O95271 | Poly [ADP-ribose] polymerase tankyrase-1 | 5.25e-02 | NA | 0.014 |
| 3. B | Q9TZC4 | Integrin-linked protein kinase homolog pat-4 | 1.63e-02 | NA | 0.011 |
| 3. B | Q66H07 | Fibronectin type 3 and ankyrin repeat domains 1 protein | 1.94e-02 | NA | 0.003 |
| 3. B | A9JR78 | Tonsoku-like protein | 5.35e-01 | NA | 0.031 |
| 3. B | Q53RE8 | Ankyrin repeat domain-containing protein 39 | 5.64e-04 | NA | 9.23e-05 |
| 3. B | Q9EP71 | Ankycorbin | 4.83e-02 | NA | 0.005 |
| 3. B | D3J162 | Protein VAPYRIN | 1.05e-01 | NA | 6.11e-06 |
| 3. B | Q0P5B9 | Ankyrin repeat domain-containing protein 39 | 1.91e-04 | NA | 7.09e-05 |
| 3. B | Q2QLB3 | Cortactin-binding protein 2 | 1.30e-01 | NA | 0.005 |
| 3. B | Q06527 | Ankyrin homolog | 1.15e-04 | NA | 0.014 |
| 3. B | Q6UB99 | Ankyrin repeat domain-containing protein 11 | 7.25e-01 | NA | 0.031 |
| 3. B | Q6PFX9 | Poly [ADP-ribose] polymerase tankyrase-1 | 1.22e-01 | NA | 0.016 |
| 3. B | O55222 | Integrin-linked protein kinase | 1.49e-02 | NA | 0.003 |
| 3. B | Q2IBB2 | Cortactin-binding protein 2 | 1.15e-01 | NA | 0.003 |
| 3. B | Q5ZLC6 | Ankyrin repeat domain-containing protein 10 | 6.97e-03 | NA | 0.001 |
| 3. B | C7B178 | Protein VAPYRIN | 1.25e-02 | NA | 6.19e-07 |
| 3. B | Q07E41 | Cortactin-binding protein 2 | 2.25e-01 | NA | 5.99e-04 |
| 3. B | Q2QLG9 | Cortactin-binding protein 2 | 2.10e-01 | NA | 7.50e-05 |
| 3. B | Q9Z2X2 | 26S proteasome non-ATPase regulatory subunit 10 | 2.70e-05 | NA | 1.92e-05 |
| 3. B | Q09YI1 | Cortactin-binding protein 2 | 2.84e-01 | NA | 3.67e-04 |
| 3. B | P97819 | 85/88 kDa calcium-independent phospholipase A2 | 5.59e-02 | NA | 0.032 |
| 3. B | Q7Z020 | Transient receptor potential cation channel subfamily A member 1 | 4.65e-01 | NA | 0.034 |
| 3. B | Q8VHK2 | Caskin-1 | 6.50e-01 | NA | 0.039 |
| 3. B | Q8N6D5 | Ankyrin repeat domain-containing protein 29 | 4.03e-04 | NA | 0.023 |
| 3. B | Q9P0K7 | Ankycorbin | 3.45e-02 | NA | 0.004 |
| 3. B | O15084 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A | 1.03e-01 | NA | 1.55e-04 |
| 3. B | O13987 | Ankyrin and IPT/TIG repeat-containing protein C26H5.05 | 1.57e-01 | NA | 0.013 |
| 3. B | Q60772 | Cyclin-dependent kinase 4 inhibitor C | 4.93e-05 | NA | 0.009 |
| 3. B | Q96AX9 | E3 ubiquitin-protein ligase MIB2 | 9.83e-02 | NA | 0.022 |
| 3. B | Q02357 | Ankyrin-1 | 9.55e-01 | NA | 0.005 |
| 3. B | A0A3L7I2I8 | 85/88 kDa calcium-independent phospholipase A2 | 1.03e-01 | NA | 0.012 |
| 3. B | Q8BTI7 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C | 1.72e-01 | NA | 0.005 |
| 3. B | Q06852 | Cell surface glycoprotein 1 | 8.43e-01 | NA | 0.008 |
| 3. B | Q923M0 | Protein phosphatase 1 regulatory subunit 16A | 1.09e-02 | NA | 0.004 |
| 3. B | Q8N8A2 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B | 4.98e-02 | NA | 0.004 |
| 3. B | Q59H18 | Serine/threonine-protein kinase TNNI3K | 7.18e-03 | NA | 9.86e-05 |
| 3. B | Q9SM23 | Acyl-CoA-binding domain-containing protein 1 | 6.89e-03 | NA | 0.005 |
| 3. B | Q5F478 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B | 5.20e-02 | NA | 0.005 |
| 3. B | Q9H9B1 | Histone-lysine N-methyltransferase EHMT1 | 1.12e-01 | NA | 2.55e-04 |
| 3. B | Q7TQP6 | Serine/threonine-protein kinase TNNI3K | 4.32e-02 | NA | 8.37e-04 |
| 3. B | Q07E28 | Cortactin-binding protein 2 | 5.32e-01 | NA | 0.001 |
| 3. B | P0CS67 | Palmitoyltransferase AKR1 | 2.16e-01 | NA | 0.014 |
| 3. B | P42773 | Cyclin-dependent kinase 4 inhibitor C | 6.10e-06 | NA | 0.023 |
| 3. B | Q8BY98 | Ankyrin repeat domain-containing protein SOWAHD | 4.60e-04 | NA | 2.89e-22 |
| 3. B | Q554E7 | Putative ZDHHC-type palmitoyltransferase 5 | 3.57e-02 | NA | 0.028 |
| 3. B | Q4JHE0 | Probable E3 ubiquitin-protein ligase XBOS36 | 6.43e-03 | NA | 7.11e-04 |
| 3. B | G5E8K5 | Ankyrin-3 | 9.83e-01 | NA | 1.83e-04 |
| 3. B | Q5GIG6 | Serine/threonine-protein kinase TNNI3K | 3.63e-02 | NA | 0.001 |
| 3. B | Q9VUX2 | E3 ubiquitin-protein ligase mind-bomb | 3.54e-01 | NA | 0.002 |
| 3. B | A0M8T5 | Cortactin-binding protein 2 | 2.22e-01 | NA | 5.13e-04 |
| 3. B | Q9DAM9 | Fibronectin type 3 and ankyrin repeat domains 1 protein | 6.58e-03 | NA | 0.003 |
| 3. B | Q7T0Q1 | Myotrophin | 1.33e-06 | NA | 0.049 |
| 3. B | Q07E15 | Cortactin-binding protein 2 | 4.47e-01 | NA | 4.02e-05 |
| 3. B | Q6P6B7 | Ankyrin repeat domain-containing protein 16 | 5.39e-04 | NA | 0.029 |
| 3. B | O60733 | 85/88 kDa calcium-independent phospholipase A2 | 6.04e-02 | NA | 0.036 |
| 3. B | Q9V7A7 | G patch domain and ankyrin repeat-containing protein 1 homolog | 1.23e-01 | NA | 0.015 |
| 3. B | O70511 | Ankyrin-3 | 9.52e-01 | NA | 3.70e-05 |
| 3. B | Q90623 | Protein phosphatase 1 regulatory subunit 12A | 3.77e-01 | NA | 5.26e-04 |
| 3. B | Q09YJ3 | Cortactin-binding protein 2 | 1.54e-01 | NA | 3.43e-04 |
| 3. B | Q12955 | Ankyrin-3 | NA | NA | 5.10e-05 |
| 3. B | Q8Q0U0 | Putative ankyrin repeat protein MM_0045 | 2.03e-04 | NA | 4.78e-04 |
| 3. B | Q9Z2X3 | 26S proteasome non-ATPase regulatory subunit 10 | 2.74e-05 | NA | 2.88e-07 |
| 3. B | Q7EZ44 | Probable E3 ubiquitin-protein ligase XBOS35 | 3.51e-02 | NA | 3.52e-04 |
| 3. B | Q755Y0 | Palmitoyltransferase AKR1 | 7.47e-02 | NA | 0.010 |
| 3. B | Q6RI86 | Transient receptor potential cation channel subfamily A member 1 | 8.29e-02 | NA | 0.002 |
| 3. B | Q10728 | Protein phosphatase 1 regulatory subunit 12A | 3.16e-01 | NA | 6.28e-04 |
| 3. B | Q1RMI3 | GA-binding protein subunit beta-1 | 8.84e-03 | NA | 0.005 |
| 3. B | Q3V0J4 | Ankyrin repeat domain-containing protein 53 | 1.24e-02 | NA | 6.90e-05 |
| 3. B | Q7Z6G8 | Ankyrin repeat and sterile alpha motif domain-containing protein 1B | 6.17e-01 | NA | 0.003 |
| 3. B | Q07DV1 | Cortactin-binding protein 2 | 2.06e-01 | NA | 5.63e-04 |
| 3. B | D3J163 | Protein VAPYRIN-LIKE | 4.41e-02 | NA | 1.46e-04 |
| 3. B | Q5R5V4 | Integrin-linked protein kinase | 2.91e-03 | NA | 0.003 |
| 3. B | O75762 | Transient receptor potential cation channel subfamily A member 1 | 2.59e-02 | NA | 0.003 |
| 3. B | O75832 | 26S proteasome non-ATPase regulatory subunit 10 | 1.24e-05 | NA | 6.83e-05 |
| 3. B | Q9STP8 | Acyl-CoA-binding domain-containing protein 2 | 4.46e-02 | NA | 0.006 |
| 3. B | Q07DW4 | Cortactin-binding protein 2 | 2.93e-01 | NA | 0.001 |
| 3. B | Q6KAE5 | Probable E3 ubiquitin-protein ligase XBOS32 | 2.55e-02 | NA | 0.049 |
| 3. B | Q4R3S3 | Ankyrin repeat domain-containing protein 7 | 5.90e-05 | NA | 0.002 |
| 3. B | Q07DX4 | Cortactin-binding protein 2 | 1.50e-01 | NA | 2.44e-04 |
| 3. B | Q38898 | Potassium channel AKT2/3 | 5.92e-02 | NA | 0.009 |
| 3. B | A0M8S4 | Cortactin-binding protein 2 | 5.26e-01 | NA | 0.003 |
| 3. B | Q8BLA8 | Transient receptor potential cation channel subfamily A member 1 | 1.15e-01 | NA | 0.002 |
| 3. B | G4SLH0 | Titin homolog | NA | NA | 0.003 |
| 3. B | Q09YK4 | Cortactin-binding protein 2 | 1.40e-01 | NA | 3.02e-04 |
| 3. B | Q8C8R3 | Ankyrin-2 | NA | NA | 4.77e-06 |
| 3. B | Q6F6B3 | Protein TANC1 | 8.71e-01 | NA | 0.003 |
| 3. B | E9Q4F7 | Ankyrin repeat domain-containing protein 11 | 8.00e-01 | NA | 0.030 |
| 3. B | Q7T3X9 | Notch-regulated ankyrin repeat-containing protein B | 2.10e-03 | NA | 0.038 |
| 3. B | Q2QLA2 | Cortactin-binding protein 2 | 2.50e-01 | NA | 0.001 |
| 3. B | Q5RF15 | Serine/threonine-protein kinase TNNI3K | 1.25e-03 | NA | 0.001 |
| 3. B | O75179 | Ankyrin repeat domain-containing protein 17 | 4.13e-01 | NA | 0.010 |
| 3. B | Q9UU77 | Ankyrin repeat-containing protein P1E11.10 | 1.62e-04 | NA | 0.012 |
| 3. B | Q8BIZ1 | Ankyrin repeat and sterile alpha motif domain-containing protein 1B | 4.48e-01 | NA | 0.002 |
| 3. B | Q09YM8 | Cortactin-binding protein 2 | 4.42e-01 | NA | 8.79e-04 |
| 3. B | Q9QZH2 | BRCA1-associated RING domain protein 1 | 1.59e-02 | NA | 0.024 |
| 3. B | Q8TC84 | Fibronectin type 3 and ankyrin repeat domains protein 1 | 2.13e-02 | NA | 4.24e-04 |
| 3. B | Q6P9K8 | Caskin-1 | 6.40e-01 | NA | 0.031 |
| 3. B | Q9D119 | Protein phosphatase 1 regulatory subunit 27 | 1.56e-05 | NA | 0.017 |
| 3. B | Q99728 | BRCA1-associated RING domain protein 1 | 4.75e-02 | NA | 0.023 |
| 3. B | Q9H2K2 | Poly [ADP-ribose] polymerase tankyrase-2 | 2.47e-01 | NA | 0.027 |
| 3. B | Q2IBA2 | Cortactin-binding protein 2 | 4.20e-01 | NA | 0.002 |
| 3. B | P97570 | 85/88 kDa calcium-independent phospholipase A2 | 7.60e-02 | NA | 0.035 |
| 3. B | A3AYR1 | Acyl-CoA-binding domain-containing protein 4 | 3.14e-02 | NA | 0.001 |
| 3. B | Q5DW34 | Histone-lysine N-methyltransferase EHMT1 | 7.64e-02 | NA | 0.002 |
| 3. B | Q07DY4 | Cortactin-binding protein 2 | 3.11e-01 | NA | 0.002 |
| 3. B | Q3SWY2 | Integrin-linked protein kinase | 1.15e-02 | NA | 0.003 |
| 3. B | Q06547 | GA-binding protein subunit beta-1 | 1.83e-02 | NA | 0.004 |
| 3. B | A5PMU4 | Ankyrin repeat and sterile alpha motif domain-containing protein 1B | 3.36e-01 | NA | 0.026 |
| 3. B | A1X157 | Cortactin-binding protein 2 | 3.57e-01 | NA | 0.001 |
| 3. B | Q9Z148 | Histone-lysine N-methyltransferase EHMT2 | 1.95e-01 | NA | 8.55e-06 |
| 3. B | Q9CZK6 | Ankyrin repeat and SAM domain-containing protein 3 | 2.75e-02 | NA | 0.016 |
| 3. B | P0DJE3 | Alpha-latrotoxin-Lhe1a | 3.38e-01 | NA | 0.038 |
| 3. B | Q5RCK5 | Ankyrin repeat and SOCS box protein 7 | 7.84e-05 | NA | 7.48e-07 |
| 3. B | Q96KQ7 | Histone-lysine N-methyltransferase EHMT2 | 7.89e-02 | NA | 4.36e-05 |
| 3. B | Q2QLF8 | Cortactin-binding protein 2 | 5.91e-01 | NA | 1.87e-04 |
| 3. B | Q2IBF7 | Cortactin-binding protein 2 | 2.57e-01 | NA | 3.59e-04 |
| 3. B | Q99J82 | Integrin-linked protein kinase | 5.76e-03 | NA | 0.003 |
| 3. B | Q8UVC1 | Inversin | 3.11e-01 | NA | 0.012 |
| 3. B | Q99LW0 | Ankyrin repeat domain-containing protein 10 | 1.11e-02 | NA | 6.99e-04 |
| 3. B | Q91ZU0 | Ankyrin repeat and SOCS box protein 7 | 1.06e-04 | NA | 7.89e-07 |
| 3. B | Q9VSA4 | Tonsoku-like protein | 5.11e-01 | NA | 0.004 |
| 3. B | Q6GNY1 | E3 ubiquitin-protein ligase mib1 | 1.31e-01 | NA | 0.037 |
| 3. B | Q3UYR4 | Espin-like protein | 6.26e-02 | NA | 4.89e-05 |
| 3. B | Q4UMH6 | Putative ankyrin repeat protein RF_0381 | 2.05e-01 | NA | 2.24e-05 |
| 3. B | Q804S5 | E3 ubiquitin-protein ligase mib1 | 2.05e-01 | NA | 0.016 |
| 3. B | Q3UES3 | Poly [ADP-ribose] polymerase tankyrase-2 | 1.15e-01 | NA | 0.029 |
| 3. B | A6NJG2 | Ankyrin repeat domain-containing protein SOWAHD | 4.34e-05 | NA | 5.33e-22 |
| 3. B | P0CS66 | Palmitoyltransferase AKR1 | 1.64e-01 | NA | 0.014 |
| 3. B | Q2IBF8 | Cortactin-binding protein 2 | 1.88e-01 | NA | 2.04e-04 |
| 3. B | Q8NB46 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C | 7.61e-02 | NA | 0.004 |
| 3. B | Q9L7Q2 | Zinc metalloprotease ZmpB | 8.83e-01 | NA | 0.006 |
| 3. B | Q108T9 | Cortactin-binding protein 2 | 3.53e-01 | NA | 8.53e-05 |
| 3. B | Q9H672 | Ankyrin repeat and SOCS box protein 7 | 1.00e-04 | NA | 8.18e-07 |
| 3. B | B1AK53 | Espin | 4.07e-01 | NA | 0.006 |
| 3. B | Q5ZIJ9 | E3 ubiquitin-protein ligase MIB2 | 1.46e-01 | NA | 1.80e-04 |
| 3. B | Q8BZ25 | Ankyrin repeat and protein kinase domain-containing protein 1 | 1.73e-02 | NA | 3.10e-04 |
| 3. B | Q8UVC3 | Inversin | 2.58e-01 | NA | 0.005 |
| 3. B | Q2IBE6 | Cortactin-binding protein 2 | 3.06e-01 | NA | 3.29e-04 |
| 3. B | P57044 | Integrin-linked protein kinase | 4.14e-03 | NA | 0.003 |
| 3. B | P50086 | Probable 26S proteasome regulatory subunit p28 | 9.59e-06 | NA | 0.005 |
| 3. B | Q09YG9 | Cortactin-binding protein 2 | 2.68e-01 | NA | 8.94e-04 |
| 3. B | Q8BG95 | Protein phosphatase 1 regulatory subunit 12B | 5.15e-01 | NA | 0.026 |
| 3. B | Q75HA6 | BTB/POZ domain and ankyrin repeat-containing protein NPR3 | 5.64e-02 | NA | 0.025 |
| 3. B | Q13418 | Integrin-linked protein kinase | 1.19e-02 | NA | 0.003 |
| 3. B | Q9BXW6 | Oxysterol-binding protein-related protein 1 | 1.34e-02 | NA | 0.002 |
| 3. B | Q52T38 | Protein S-acyltransferase 24 | 1.26e-02 | NA | 0.014 |
| 3. B | Q8WXD9 | Caskin-1 | 9.56e-01 | NA | 0.030 |
| 3. B | P46683 | Ankyrin repeat-containing protein YAR1 | 6.34e-04 | NA | 0.049 |
| 3. B | P0C6S7 | Ankyrin repeat and sterile alpha motif domain-containing protein 1B | 3.13e-01 | NA | 0.003 |
| 3. B | Q5ZLC8 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C | 1.35e-01 | NA | 0.001 |
| 3. B | Q505D1 | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A | 1.54e-01 | NA | 1.85e-04 |
| 3. B | O90760 | Putative ankyrin repeat protein FPV031 | NA | NA | 2.20e-04 |
| 3. B | Q01484 | Ankyrin-2 | NA | NA | 8.39e-06 |
| 3. B | Q8WZ74 | Cortactin-binding protein 2 | 1.57e-01 | NA | 3.24e-04 |
| 3. B | P81069 | GA-binding protein subunit beta-2 | 1.15e-02 | NA | 0.032 |
| 3. B | Q9DF58 | Integrin-linked protein kinase | 1.25e-02 | NA | 8.33e-04 |
| 3. B | Q9NXR5 | Ankyrin repeat domain-containing protein 10 | 9.32e-03 | NA | 7.49e-04 |
| 3. B | Q8NFD2 | Ankyrin repeat and protein kinase domain-containing protein 1 | 3.18e-02 | NA | 0.003 |
| 3. B | Q00420 | GA-binding protein subunit beta-1 | 4.91e-03 | NA | 0.003 |
| 3. B | Q6NLQ8 | E3 ubiquitin-protein ligase XBAT32 | 1.60e-02 | NA | 1.39e-04 |
| 3. B | Q6DRG7 | Protein phosphatase 1 regulatory subunit 12A | 7.32e-01 | NA | 2.29e-04 |
| 3. B | Q9DBR7 | Protein phosphatase 1 regulatory subunit 12A | 5.71e-01 | NA | 6.89e-04 |
| 3. B | Q4R739 | Ankyrin repeat domain-containing protein 53 | 6.73e-02 | NA | 0.006 |
| 3. B | Q86WC6 | Protein phosphatase 1 regulatory subunit 27 | 1.86e-05 | NA | 0.012 |
| 3. B | Q9VBP3 | Poly [ADP-ribose] polymerase tankyrase | 2.28e-01 | NA | 0.036 |
| 3. B | Q2QL82 | Cortactin-binding protein 2 | 1.81e-01 | NA | 1.50e-04 |
| 3. B | Q6ZVH7 | Espin-like protein | 4.47e-02 | NA | 8.07e-04 |
| 3. B | Q9FF09 | Phytochrome-interacting ankyrin-repeat protein 1 | 3.87e-03 | NA | 0.042 |